The study of biodegradation of galanin and its N-terminal fragments in a model system in vitro

    
Avdeev D.V.1 , Selyutina O.Yu.2, Sidorova M.V.1, Pisarenko O.I.1

1. Chazov National Medical Research Center for Cardiology, Moscow, Russia
2. Institute of Chemical Kinetics and Combustion SB RAS, Novosibirsk, Russia
Section: Clinical and Diagnostic Research
DOI: 10.18097/PBMCR1540      PubMed Id: 40045726
Year: 2025  Volume: 71  Issue: 1  Pages: 71-76
Exogenous N-terminal fragments of galanin, which are agonists of the GalR2 receptor, have therapeutic potential in experimental cardiac pathology. This implies the need to study their proteolytic stability in biological environments. The aim of this work was to evaluate the proteolytic degradation of galanin G1 (GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH₂), its natural and modified fragments G2 and G3 (WTLNSAGYLLGPHA-OH and WTLNSAGYLLGPβAH-OH, respectively) in human plasma. The peptides were obtained by solid-phase synthesis using the Fmoc methodology, purified by HPLC; their structure was confirmed by MALDI-TOF mass spectrometry and ¹H-NMR spectroscopy. The kinetics of galanins G1–G3 degradation in blood plasma was studied by ¹H-NMR spectroscopy based on changes in the intensity of Trp2 signals at 310 K. The results indicate a higher proteolytic stability of the G3 peptide compared to the natural G2 fragment and full-length galanin G1. They indicate the potential of using modified peptide agonists of GalR2 receptors to protect vital organs in pathophysiological conditions.
Download PDF:  
Keywords: galanin, N-terminal fragments of galanin, 1H NMR, human plasma
Citation:

Avdeev, D. V., Selyutina, O. Yu., Sidorova, M. V., Pisarenko, O. I. (2025). The study of biodegradation of galanin and its N-terminal fragments in a model system in vitro. Biomeditsinskaya Khimiya, 71(1), 71-76.
References  
 2026 (vol 72)
 2025 (vol 71)
 2024 (vol 70)
 2023 (vol 69)
 2022 (vol 68)
 2021 (vol 67)
 2020 (vol 66)
 2019 (vol 65)
 2018 (vol 64)
 2017 (vol 63)
 2016 (vol 62)
 2015 (vol 61)
 2014 (vol 60)
 2013 (vol 59)
 2012 (vol 58)
 2011 (vol 57)
 2010 (vol 56)
 2009 (vol 55)
 2008 (vol 54)
 2007 (vol 53)
 2006 (vol 52)
 2005 (vol 51)
 2004 (vol 50)
 2003 (vol 49)