Exogenous N-terminal fragments of galanin, which are agonists of the GalR2 receptor, have therapeutic potential in experimental cardiac pathology. This implies the need to study their proteolytic stability in biological environments. The aim of this work was to evaluate the proteolytic degradation of galanin G1 (GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH₂), its natural and modified fragments G2 and G3 (WTLNSAGYLLGPHA-OH and WTLNSAGYLLGPβAH-OH, respectively) in human plasma. The peptides were obtained by solid-phase synthesis using the Fmoc methodology, purified by HPLC; their structure was confirmed by MALDI-TOF mass spectrometry and ¹H-NMR spectroscopy. The kinetics of galanins G1–G3 degradation in blood plasma was studied by ¹H-NMR spectroscopy based on changes in the intensity of Trp2 signals at 310 K. The results indicate a higher proteolytic stability of the G3 peptide compared to the natural G2 fragment and full-length galanin G1. They indicate the potential of using modified peptide agonists of GalR2 receptors to protect vital organs in pathophysiological conditions.
Download PDF:
Keywords: galanin, N-terminal fragments of galanin, 1H NMR, human plasma
Citation:
Avdeev D.V., Selyutina O.Yu., Sidorova M.V., Pisarenko O.I. (2025) The study of biodegradation of galanin and its N-terminal fragments in a model system in vitro. Biomeditsinskaya Khimiya, 71(1), 71-76.
Avdeev D.V. et al. The study of biodegradation of galanin and its N-terminal fragments in a model system in vitro // Biomeditsinskaya Khimiya. - 2025. - V. 71. -N 1. - P. 71-76.
Avdeev D.V. et al., "The study of biodegradation of galanin and its N-terminal fragments in a model system in vitro." Biomeditsinskaya Khimiya 71.1 (2025): 71-76.
Avdeev, D. V., Selyutina, O. Yu., Sidorova, M. V., Pisarenko, O. I. (2025). The study of biodegradation of galanin and its N-terminal fragments in a model system in vitro. Biomeditsinskaya Khimiya, 71(1), 71-76.
References
Lang R., Gundlach A.L., Holmes F.E., Hobson S.A., Wynick D., Hökfelt T., Kofler B. (2015) Physiology, signaling, and pharmacology of galanin peptides and receptors: three decades of emerging diversity. Pharmacol. Rev., 67(1), 118–175. CrossRef Scholar google search
Pisarenko O.I., Studneva I.M., Veselova O.M. (2021) Modified N-terminal fragments of galanin: cardioprotective properties and mechanisms of action. Biochemistry (Moscow), 86(10), 1502–1512. CrossRef Scholar google search
Serebryakova L., Veselova O., Studneva I., Dobrokhotov I., Palkeeva M., Avdeev D., Molokoedov A., Ovchinnikov M., Sidorova M., Pisarenko O. (2022) Exogenous GalR2-specific peptide agonist as a tool for treating myocardial ischemia/reperfusion injury. Fundam. Clin. Pharmacol., 37(6), 1109–1118. CrossRef Scholar google search
Pisarenko O., Timotin A., Sidorova M., Studneva I., Shulzhenko V., Palkeeva M., Serebryakova L., Molokoedov A., Veselova O., Cinato M., Boal F., Tronchere H., Kunduzova O. (2017) Cardioprotective properties of N-terminal galanin fragment (2-15) in experimental ischemia/reperfusion injury. Oncotarget, 8(60), 101659–101671. CrossRef Scholar google search
Studneva I.M., Veselova O.M., Bahtin A.A., Konovalova G.G., Lankin V.Z., Pisarenko O.I. (2020) The mechanisms of cardiac protection using a synthetic agonist of galanin receptors during chronic administration of doxorubicin. Acta Naturae, 12(1), 89–98. CrossRef Scholar google search
Boal F., Cinato M., Timotin A., Münzberg H., Qualls-Creekmore E., Kramar S., Loi H., Roncalli J., Keita S., Tronchere H., Kunduzova O. (2022) Galanin regulates myocardial mitochondrial ROS homeostasis and hypertrophic remodeling through GalR2. Front. Pharmacol., 13, 869179. CrossRef Scholar google search
Martinelli I., Timotin A., Moreno-Corchado P., Marsal D., Kramar S., Loy H., Joffre C., Boal F., Tronchere H., Kunduzova O. (2021) Galanin promotes autophagy and alleviates apoptosis in the hypertrophied heart through FoxO1 pathway. Redox Biol., 40, 101866. CrossRef Scholar google search
Holst J.J., Bersani M., Hvidberg A., Knigge U., Christiansen E., Madsbad S., Harling H., Kofod H. (1993) On the effects of human galanin in man. Diabetologia, 36(7), 653–657. CrossRef Scholar google search
Carey D.G., Iismaa T.P., Ho K.Y., Rajkovic I.A., Kelly J., Kraegen E.W., Ferguson J., Inglis A.S., Shine J., Chisholm D.J. (1993) Potent effects of human galanin in man: growth hormone secretion and vagal blockade. J. Clin. Endocrinol. Metab., 77(1), 90–93. CrossRef Scholar google search
Sidorova M.V., Palkeeva M.E., Avdeev D.V., Molokoedov A.S., Ovchinnikov M.V., Azmuko A.A., Serebryakova L.I., Veselova O.M., Studneva I.M., Pisarenko O.I. (2020) Convergent synthesis of the rat galanin and study of its biological activity. Russ. J. Bioorg. Chem., 46(1), 32–42. CrossRef Scholar google search
Lundström L., Lu X., Langel U., Bartfai T. (2005) Important pharmacophores for binding to galanin receptor 2. Neuropeptides, 39(3), 169–171. CrossRef Scholar google search
Vlieghe P., Lisowski V., Martinez J., Khrestchatisky M. (2010) Synthetic therapeutic peptides: science and market. Drug Discov. Today, 15(1–2), 40–56. CrossRef Scholar google search
Palkeeva M., Studneva I., Molokoedov A., Serebryakova L., Veselova O., Ovchinnikov M., Sidorova M., Pisarenko O. (2019) Galanin/GalR1-3 system: a promising therapeutic target for myocardial ischemia/reperfusion injury. Biomed. Pharmacother., 109, 1556–1562. CrossRef Scholar google search
Khapchaev A.Y., Kazakova O.A., Samsonov M.V., Sidorova M.V., Bushuev V.N., Vilitkevich E.L., Az’muko A.A., Molokoedov A.S., Bespalova Zh.D., Shirinsky V.P. (2016) Design of peptidase-resistant peptide inhibitors of myosin light chain kinase J. Pept. Sci., 22(11–12), 673–681. CrossRef Scholar google search
Sidorova M., Studneva I., Bushuev V., Pal’keeva M., Molokoedov A., Veselova O., Ovchinnikov M., Pisarenko O. (2020) [MeArg1, NLe10]-apelin-12: optimization of solid-phase synthesis and evaluation of biological properties in vitro and in vivo. Peptides, 129(8), 170320. CrossRef Scholar google search
Saar I., Runesson J., McNamara I., Järv J., Robinson J.K., Langel U. (2011) Novel galanin receptor subtype specific ligands in feeding regulation. Neurochem. Int., 58(6), 714–720. CrossRef Scholar google search
Fisone G., Berthold M., Bedecs K., Undén A., Bartfai T., Bertorelli R., Consolo S., Crawley J., Martin B., Nilsson S. (1989) N-Terminal galanin-(1-16) fragment is an agonist at the hippocampal galanin receptor. Proc. Natl. Acad. Sci. USA, 86(23), 9588–9591. CrossRef Scholar google search
Serebryakova L., Studneva I., Timoshin A., Veselova O., Palkeeva M., Ovchinnikov M., Az’muko A., Molokoedov A., Sidorova M., Pisarenko O. (2021) Galanin peptides alleviate myocardial ischemia/reperfusion injury by reducing reactive oxygen species formation. Int. J. Pept. Res. Ther., 27(4), 2039–2048. CrossRef Scholar google search
Studneva I., Palkeeva M., Veselova O., Molokoedov A., Ovchinnikov M., Sidorova M., Pisarenko O. (2019) Protective effects of a novel agonist of galanin receptors against doxorubicin-induced cardiotoxicity in rats. Cardiovasc. Toxicol., 19(2), 136–146. CrossRef Scholar google search
Hinghofer-Szalkay H.G., Rössler A., Evans J.M., Stenger M.B., Moore F.B., Knapp C.F. (2006) Circulatory galanin levels increase severalfold with intense orthostatic challenge in healthy humans. J. Appl. Physiol., 100(3), 844–849. CrossRef Scholar google search
Alston E.N., Parrish D.C., Hasan W., Tharp K., Pahlmeyer L., Habecker B.A. (2011) Cardiac ischemia-reperfusion regulates sympathetic neuropeptide expression through gp130-dependent and independent mechanisms. Neuropeptides, 45(1), 33–42. CrossRef Scholar google search
Šípková J., Šída P., Kaspříková N., Kramáriková I., Hynie S., Klenerová V. (2017) Effect of stress on the expression of galanin receptors in rat heart. Folia Biologica (Praha), 63(3), 98–104. CrossRef Scholar google search
